PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 302aa    MW: 34058 Da    PI: 6.0323
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G00270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573115.33.5e-3664159398
       DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  + r+w+eeDe+++L+Gl+d++aktg +p+ d+daf++f+ +si  ++sk+q+++Kir+LK++f+ +++k+++g++p+f++++d+++f++s++iWg+
  AT4G00270.1  64 IVRIWNEEDELSILKGLVDYRAKTGFNPKIDWDAFCSFLGSSIVERFSKDQVLSKIRKLKRRFHVHSEKINQGNDPKFTRSSDSEAFGFSSMIWGQ 159
                  68********************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.5E-2765158IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVTPKQIDFS SCVGADNSNG TLSHRRSPRN IPSSKRAASV AEEETMKKKM KMKKKKKKLD  60
PPLIVRIWNE EDELSILKGL VDYRAKTGFN PKIDWDAFCS FLGSSIVERF SKDQVLSKIR  120
KLKRRFHVHS EKINQGNDPK FTRSSDSEAF GFSSMIWGQG DDDGMDKEHE VNGNGAAENR  180
TNESGEEMLK EHEEEVANTE LLNENGAAKT TENGTSSGKE RHDEDNDDDD ELCAVQDAFE  240
AVMSQGLSGY QKKLQLEKLM NLGNGKRREL SDEWKALCVE ETRFNIKKLR FSAKLAEAAN  300
DS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.286980.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453398410.0
Genevisible265908_at0.0
Expression AtlasAT4G00270-
AtGenExpressAT4G00270-
ATTED-IIAT4G00270-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00061PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G00270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G00270, AT5G14280
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G00270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3615900.0AF361590.1 Arabidopsis thaliana AT4g00270/A_IG005I10_11 mRNA, complete cds.
GenBankAY0748370.0AY074837.1 Arabidopsis thaliana AT4g00270/A_IG005I10_11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567163.10.0DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLQ9ASZ10.0Q9ASZ1_ARATH; AT4g00270/A_IG005I10_11
STRINGAT4G00270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Representative plantOGRP4222523
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. Wagner S, et al.
    Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis.
    Plant Cell, 2006. 18(7): p. 1722-35
    [PMID:16766694]
  4. Chevalier F, et al.
    GeBP and GeBP-like proteins are noncanonical leucine-zipper transcription factors that regulate cytokinin response in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1142-54
    [PMID:18162594]
  5. Luhua S, et al.
    Linking genes of unknown function with abiotic stress responses by high-throughput phenotype screening.
    Physiol Plant, 2013. 148(3): p. 322-33
    [PMID:23517122]